PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN41171.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 337aa    MW: 37704.6 Da    PI: 6.8536
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN41171.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.6e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l ++++ +G+g+W++ ++  g++R++k+c++rw +yl
       KHN41171.1 14 KGPWTPEEDLKLTNYIQIHGPGNWRSLPKNAGLRRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.98.5e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE++ +++++  lG++ W++Ia++++ gRt++++k++w+++
       KHN41171.1  67 RGRFSLEEEDVIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.093961IPR017930Myb domain
SuperFamilySSF466898.24E-3111108IPR009057Homeodomain-like
SMARTSM007178.2E-151363IPR001005SANT/Myb domain
PfamPF002492.6E-161461IPR001005SANT/Myb domain
CDDcd001674.33E-121661No hitNo description
PROSITE profilePS5129425.63962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2665116IPR009057Homeodomain-like
SMARTSM007171.4E-1566114IPR001005SANT/Myb domain
PfamPF002495.0E-1567111IPR001005SANT/Myb domain
CDDcd001671.08E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MGRAPCCDEN GLKKGPWTPE EDLKLTNYIQ IHGPGNWRSL PKNAGLRRCG KSCRLRWTNY  60
LRPDIKRGRF SLEEEDVIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHTPRL DLLDMSSILR SMLGNPSLLN MQGLLGAQVL MNQGLLKLAS TASLLSTINN  180
DENPNLASQN FVHSQVATTP PSLDSTQFQF QMPTNQTNNV EVEGFLGTVT NLSCSSSPSG  240
DDKINLVLQQ KNQVDLLGNH DVLVHSLYNA KNQNMGCDSV MRTPVSSPNR LNSSSNYVKS  300
GTEEERESFC SDLFEFEIPE SLDFADIFCN VPYTPIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-30121162105MYB PROTO-ONCOGENE PROTEIN
1mse_C7e-30121162105C-Myb DNA-Binding Domain
1msf_C7e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150392e-66AP015039.1 Vigna angularis var. angularis DNA, chromosome 6, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003526296.10.0PREDICTED: transcription factor MYB39-like
SwissprotQ8GWP09e-72MYB39_ARATH; Transcription factor MYB39
TrEMBLA0A0B2S3610.0A0A0B2S361_GLYSO; Transcription factor MYB39
TrEMBLI1KF770.0I1KF77_SOYBN; Uncharacterized protein
STRINGGLYMA06G45460.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-94MYB-like 102
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]